PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.271780.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 456aa    MW: 50524.9 Da    PI: 6.7019
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.271780.9genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.91.5e-073934262154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  Cucsa.271780.9 393 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 426
                     469*****************************87 PP

2ELK223.9e-08347368122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+ +Y+++++++++E++
  Cucsa.271780.9 347 ELKHELKSGYKEKIVDIREEIL 368
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.3E-20189233IPR005540KNOX1
PfamPF037907.5E-18191232IPR005540KNOX1
SMARTSM012561.2E-17239290IPR005541KNOX2
PfamPF037914.0E-13249289IPR005541KNOX2
PfamPF037897.3E-6347368IPR005539ELK domain
SMARTSM011880.0018347368IPR005539ELK domain
PROSITE profilePS512139.446347367IPR005539ELK domain
PROSITE profilePS5007111.855367430IPR001356Homeobox domain
SuperFamilySSF466895.99E-16369433IPR009057Homeodomain-like
SMARTSM003894.0E-11369434IPR001356Homeobox domain
CDDcd000862.01E-12370431No hitNo description
Gene3DG3DSA:1.10.10.607.6E-25374431IPR009057Homeodomain-like
PfamPF059201.3E-17387426IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MAYHNHLSQD LPLHFSDHHH QNQPLSDSSS LRNILPDQLP AGHTSPDPKS QQPHHHHHHQ  60
HPLQTAPNWL NNALLRNQNP HSHFSTDTAT TAAAANTNFL NLHTTASDST VSHSSNQWLS  120
RPILHRNHSD VIDDVAAGDA MIGAATAALS HDSGDLKNDA NSGDGLNKSE GMVMEPGAGG  180
EGVLNWQHAR YKAEILAHPL YEQLLSAHVA CLRIATPVDQ LPRIDAQLAQ SQNVVAKYSA  240
LGHSAPPSMT HYVLLLCSFK EQLQQHVRVH AMEAVMACWD IEQSLQSLTG VSPGEGTGAT  300
MSDDDDDQVD SDANVFDGSL DGPDTMGFGP LIPTESERSL MERVRQELKH ELKSGYKEKI  360
VDIREEILRK RRAGKLPGDT TSVLKQWWQS HSKWPYPTEE DKARLVQETG LQLKQINNWF  420
INQRKRNWHS NPSSSTNLKS KRKSNAGENS SDRFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A3e-12370434872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011654241.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X2
SwissprotO041360.0KNAP3_MALDO; Homeobox protein knotted-1-like 3
TrEMBLA0A0A0L5P60.0A0A0A0L5P6_CUCSA; Uncharacterized protein
STRINGGLYMA04G06810.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-170KNOTTED1-like homeobox gene 3